PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp1016s0011.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 617aa    MW: 67261.9 Da    PI: 4.8624
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp1016s0011.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.5e-33206262259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +DgynWrKYGqK+vkgsefprsYY+Ct+++C+++k+ver++ d++++ei+Y+g+Hnh+
  Kaladp1016s0011.1.p 206 EDGYNWRKYGQKQVKGSEFPRSYYKCTHPNCEMRKQVERTH-DGQITEIVYKGNHNHP 262
                          7***************************************9.***************8 PP

2WRKY104.46.1e-33396454159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+ +d+k+v++tYeg+Hnhe
  Kaladp1016s0011.1.p 396 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTPGCLVRKHVERAPDDNKCVVTTYEGKHNHE 454
                          59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081124.512200264IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.6E-29202264IPR003657WRKY domain
SuperFamilySSF1182906.67E-26202264IPR003657WRKY domain
SMARTSM007741.1E-36205263IPR003657WRKY domain
PfamPF031062.4E-26206262IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.6E-35381456IPR003657WRKY domain
PROSITE profilePS5081136.896391456IPR003657WRKY domain
SuperFamilySSF1182901.24E-28391456IPR003657WRKY domain
SMARTSM007746.0E-38396455IPR003657WRKY domain
PfamPF031065.5E-25397454IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 617 aa     Download sequence    Send to blast
MEPPDEYAAE EWNPAAAGSS SSSAPRMNPD PLIDPAVMMI PNSQPSPTTG SYYSPPFNQD  60
LSFLTNSMAA PTAAGGYCDS LPFFHGSEHP AGEVNNLHYF KHLETQDLDG GFLNLPSQQL  120
PIEFELPVLS NEFIASASIR NDYIDVDFLS PADLSNAHTT LPPSQPNDHI TSQRNDHMYI  180
DGAADHVMEE EKRASSPPMG GMRTTEDGYN WRKYGQKQVK GSEFPRSYYK CTHPNCEMRK  240
QVERTHDGQI TEIVYKGNHN HPQPMPNRRL TPDSAFAQNE MDAGEGCGGG TSRGKNEGLD  300
RALSEPILTE LSPTGREKRF SAFDSSEAAE LASPLHNHAA EDDEAVEENM ADANEVHNDA  360
TDLRRAEDCM VEPSMSSRGV REQKIVVEIE TEVDILDDGY RWRKYGQKVV KGNPNPRSYY  420
KCTTPGCLVR KHVERAPDDN KCVVTTYEGK HNHEVPAAKN SSNASPNAGH LSSAHPVGQP  480
SHMPLAGSAA ITMPAQAQFQ PPPFESKPYM GNGFSAHSLP GNFGNDVSFG ASSMYPMLYG  540
SFGLAASYPN IQRAGLSISR SPILDSAAAN PMTLHYGFDN HRGGGVIQTA HPGDENDPTR  600
RGPKQDEAND EPADDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-32206457878Probable WRKY transcription factor 4
2lex_A1e-32206457878Probable WRKY transcription factor 4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-72WRKY family protein